PDB entry 1ds5

View 1ds5 on RCSB PDB site
Description: dimeric crystal structure of the alpha subunit in complex with two beta peptides mimicking the architecture of the tetrameric protein kinase ck2 holoenzyme.
Class: transferase
Keywords: protein-complex, tetramer
Deposited on 2000-01-07, released 2001-01-07
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.16 Å
R-factor: 0.214
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: casein kinase, alpha chain
    Species: Zea mays
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ds5a_
  • Chain 'B':
    Compound: casein kinase, alpha chain
    Species: Zea mays
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ds5b_
  • Chain 'C':
    Compound: casein kinase, alpha chain
    Species: Zea mays
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ds5c_
  • Chain 'D':
    Compound: casein kinase, alpha chain
    Species: Zea mays
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ds5d_
  • Chain 'E':
    Compound: casein kinase, beta chain
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: casein kinase, beta chain
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: casein kinase, beta chain
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: casein kinase, beta chain
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ds5A (A:)
    mskarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekc
    iikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvly
    ptltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpg
    keynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvki
    akvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkll
    rydhqerltaleamthpyfqqvraaensrtra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ds5A (A:)
    mskarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekc
    iikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvly
    ptltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpg
    keynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvki
    akvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkll
    rydhqerltaleamthpyfqqvraaens
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ds5B (B:)
    mskarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekc
    iikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvly
    ptltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpg
    keynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvki
    akvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkll
    rydhqerltaleamthpyfqqvraaensrtra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ds5B (B:)
    mskarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekc
    iikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvly
    ptltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpg
    keynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvki
    akvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkll
    rydhqerltaleamthpyfqqvraaens
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ds5C (C:)
    mskarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekc
    iikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvly
    ptltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpg
    keynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvki
    akvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkll
    rydhqerltaleamthpyfqqvraaensrtra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ds5C (C:)
    mskarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekc
    iikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvly
    ptltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpg
    keynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvki
    akvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkll
    rydhqerltaleamthpyfqqvraaens
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ds5D (D:)
    mskarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekc
    iikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvly
    ptltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpg
    keynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvki
    akvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkll
    rydhqerltaleamthpyfqqvraaensrtra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ds5D (D:)
    mskarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekc
    iikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvly
    ptltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpg
    keynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvki
    akvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkll
    rydhqerltaleamthpyfqqvraaens
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.