PDB entry 1ds4

View 1ds4 on RCSB PDB site
Description: cytochrome c peroxidase h175g mutant, imidazole complex, ph 6, 100k
Class: oxidoreductase
Keywords: heme enzyme, peroxidase, cavity mutant, ligand binding
Deposited on 2000-01-07, released 2001-03-07
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.187
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (0-291)
      • conflict (0)
      • conflict (50)
      • conflict (73)
      • conflict (149)
      • engineered (172)
    Domains in SCOP 1.73: d1ds4a_
  • Heterogens: HEM, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ds4A (A:)
    tlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdn
    tggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgp
    kipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgagalgkthl
    knsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdp
    kylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl