PDB entry 1drz

View 1drz on RCSB PDB site
Description: u1a spliceosomal protein/hepatitis delta virus genomic ribozyme complex
Deposited on 1998-09-01, released 1999-02-16
The last revision prior to the SCOP 1.57 freeze date was dated 2000-05-12, with a file datestamp of 2000-05-12.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.281
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1drza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1drzA (A:)
    petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
    satnalrsmqgfpfydkpmriqyaktdsdiiakmk