PDB entry 1dru

View 1dru on RCSB PDB site
Description: escherichia coli dhpr/nadh complex
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1996-06-28, released 1997-01-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.192
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrodipicolinate reductase
    Species: Escherichia coli [TaxId:562]
    Gene: DAPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1drua1, d1drua2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1druA (A:)
    mhdanirvaiagaggrmgrqliqaalalegvqlgaaleregssllgsdagelagagktgv
    tvqssldavkddfdvfidftrpegtlnhlafcrqhgkgmvigttgfdeagkqairdaaad
    iaivfaanfsvgvnvmlkllekaakvmgdytdieiieahhrhkvdapsgtalamgeaiah
    aldkdlkdcavysreghtgervpgtigfatvragdivgehtamfadigerleithkassr
    mtfangavrsalwlsgkesglfdmrdvldlnnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1druA (A:)
    anirvaiagaggrmgrqliqaalalegvqlgaaleregssllgsdagelagagktgvtvq
    ssldavkddfdvfidftrpegtlnhlafcrqhgkgmvigttgfdeagkqairdaaadiai
    vfaanfsvgvnvmlkllekaakvmgdytdieiieahhrhkvdapsgtalamgeaiahald
    kdlkdcavysreghtgervpgtigfatvragdivgehtamfadigerleithkassrmtf
    angavrsalwlsgkesglfdmrdvldlnnl