PDB entry 1dr9

View 1dr9 on RCSB PDB site
Description: crystal structure of a soluble form of b7-1 (cd80)
Deposited on 2000-01-06, released 2000-01-10
The last revision prior to the SCOP 1.67 freeze date was dated 2001-01-10, with a file datestamp of 2001-01-10.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.238
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dr9A (A:)
    vihvtkevkevatlscghnvsveelaqtriywqkekkmvltmmsgdmniwpeyknrtifd
    itnnlsivilalrpsdegtyecvvlkyekdafkrehlaevtlsvkadfptpsisdfeipt
    snirriicstsggfpephlswlengeelnainttvsqdpetelyavsskldfnmttnhsf
    mclikyghlrvnqtfnwntak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dr9A (A:)
    vihvtkevkevatlscghnvsveelaqtriywqkekkmvltmmsgdmniwpeyknrtifd
    itnnlsivilalrpsdegtyecvvlkyekdafkrehlaevtlsvkadfptpsisdfeipt
    snirriicstsggfpephlswlengeelnainttvsqdpetelyavsskldfnmttnhsf
    mclikyghlrvnqtfnwnta