PDB entry 1dqu

View 1dqu on RCSB PDB site
Description: crystal structure of the isocitrate lyase from aspergillus nidulans
Deposited on 2000-01-05, released 2000-05-10
The last revision prior to the SCOP 1.71 freeze date was dated 2000-05-10, with a file datestamp of 2000-05-10.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.276
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1dqua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dquA (A:)
    msyieeedqrywdevaavknwwkdsrwrytkrpftaeqivakrgnlkieypsnvqakklw
    gilernfknkeasftygcldptmvtqmakyldtvyvsgwqssstasstdepspdladypm
    ntvpnkvnhlwmaqlfhdrkqreermttpkdqrhkvanvdylrpiiadadtghggltavm
    kltklfvergaagihiedqapgtkkcghmagkvlvpisehinrlvairaqadimgtdlla
    iartdseaatlitstidhrdhpfiigstnpdiqplndlmvmaeqagkngaelqaiedewl
    akaglklfndavvdainnsplpnkkaaiekyltqskgksnlearaiakeiagtdiyfdwe
    aprtregyyryqggtqcainravayapfadliwmesklpdykqakefadgvhavwpeqkl
    aynlspsfnwkkamprdeqetyikrlgalgyawqfitlaglhttalisdtfakayakqgm
    raygelvqepemangvdvvthqkwsganyvdnmlkmitggvsstaamgkgvtedqfks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dquA (A:)
    syieeedqrywdevaavknwwkdsrwrytkrpftaeqivakrgnlkieypsnvqakklwg
    ilernfknkeasftygcldptmvtqmakyldtvyvsgwqssstasstdepspdladypmn
    tvpnkvnhlwmaqlfhdrkqreermttpkdqrhkvanvdylrpiiadadtghggltavmk
    ltklfvergaagihiedqapgtkgkvlvpisehinrlvairaqadimgtdllaiartdse
    aatlitstidhrdhpfiigstnpdiqplndlmvmaeqagkngaelqaiedewlakaglkl
    fndavvdainnsplpnkkaaiekyltqskgksnlearaiakeiagtdiyfdweaprtreg
    yyryqggtqcainravayapfadliwmesklpdykqakefadgvhavwpeqklaynlsps
    fnwkkamprdeqetyikrlgalgyawqfitlaglhttalisdtfakayakqgmraygelv
    qepemangvdvvthqkwsganyvdnmlkmitgg