PDB entry 1dqe

View 1dqe on RCSB PDB site
Description: bombyx mori pheromone binding protein
Class: transport protein
Keywords: helical bundle
Deposited on 2000-01-04, released 2001-01-10
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.21
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pheromone-binding protein
    Species: Bombyx mori
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1dqea_
  • Chain 'B':
    Compound: pheromone-binding protein
    Species: Bombyx mori
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1dqeb_
  • Heterogens: BOM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dqeA (A:)
sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
eihklnwapsmdvavge

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dqeB (B:)
sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
eihklnwapsmdvavge