PDB entry 1dqe

View 1dqe on RCSB PDB site
Description: bombyx mori pheromone binding protein
Deposited on 2000-01-04, released 2001-01-10
The last revision prior to the SCOP 1.67 freeze date was dated 2001-01-10, with a file datestamp of 2001-01-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.21
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1dqea_
  • Chain 'B':
    Domains in SCOP 1.67: d1dqeb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dqeA (A:)
    sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
    mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
    eihklnwapsmdvavge
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dqeB (B:)
    sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
    mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
    eihklnwapsmdvavge