PDB entry 1dqd

View 1dqd on RCSB PDB site
Description: crystal structure of fab hgr-2 f6, a competitive antagonist of the glucagon receptor
Class: immune system
Keywords: Glucagon receptor, monoclonal antibody, Fab, receptor antagonist, typical immunoglobulin fold, light chain, heavy chain, antigen binding site, complementarity-determining regions, IMMUNE SYSTEM
Deposited on 2000-01-04, released 2000-05-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.217
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: fab hgr-2 f6
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1DQD (0-221)
    Domains in SCOPe 2.06: d1dqdh1, d1dqdh2
  • Chain 'L':
    Compound: fab hgr-2 f6
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1DQD (Start-220)
    Domains in SCOPe 2.06: d1dqdl1, d1dqdl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1dqdH (H:)
    evqlqesgpslvkpsqtlsltcsvtgdsitsgywnwirkfpgnkleymgyisysgstyyn
    pslksrlsitrdtsrnqyylqlksvtpedtatyycasppgyygsgpyamdywgqgtsvtv
    ssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkispg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dqdH (H:)
    evqlqesgpslvkpsqtlsltcsvtgdsitsgywnwirkfpgnkleymgyisysgstyyn
    pslksrlsitrdtsrnqyylqlksvtpedtatyycasppgyygsgpyamdywgqgtsvtv
    ssakttppsvyplapgsaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpsstwpsetvtcnvahpasstkvdkkispg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1dqdL (L:)
    aaqpamadivlsqspaimsaspgekvtitcsasssvsymhwfqqkpgtspklciyttsnl
    asgvparfsgsgsgtsysltisrmeaedaatyycqqrstypptfgsgtkleikradaapt
    vsifppsseqltsggasvvcflnnfyprdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrneca
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dqdL (L:)
    divlsqspaimsaspgekvtitcsasssvsymhwfqqkpgtspklciyttsnlasgvpar
    fsgsgsgtsysltisrmeaedaatyycqqrstypptfgsgtkleikradaaptvsifpps
    seqltsggasvvcflnnfyprdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrneca