PDB entry 1dqb

View 1dqb on RCSB PDB site
Description: nmr structure of thrombomodulin egf(4-5)
Class: membrane protein
Keywords: thrombin, egf module, anticoagulant, glycosylation, membrane protein
Deposited on 2000-01-03, released 2000-03-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thrombomodulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07204 (0-82)
    • conflict (0-1)
  Domains in SCOPe 2.06: d1dqba1, d1dqba2
• Heterogens: NAG

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dqbA (A:)
  hmepvdpcfranceyqcqplnqtsylcvcaegfapiphephrcqmfcnqtacpadcdpnt
  qascecpegyilddgfictdide