PDB entry 1dqb

View 1dqb on RCSB PDB site
Description: nmr structure of thrombomodulin egf(4-5)
Class: membrane protein
Keywords: nmr, thrombin, egf module, anticoagulant, glycosylation
Deposited on 2000-01-03, released 2000-03-06
The last revision prior to the SCOP 1.75 freeze date was dated 2003-09-23, with a file datestamp of 2007-06-04.
Experiment type: NMR12
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thrombomodulin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07204 (0-82)
      • conflict (0-1)
    Domains in SCOP 1.75: d1dqba1, d1dqba2
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dqbA (A:)
    hmepvdpcfranceyqcqplnqtsylcvcaegfapiphephrcqmfcnqtacpadcdpnt
    qascecpegyilddgfictdide