PDB entry 1dq5

View 1dq5 on RCSB PDB site
Description: Manganese;Manganese concanavalin A at pH 5.0
Class: sugar binding protein
Keywords: concanavalin A, lecin, metal binding, manganese, binuclear, SUGAR BINDING PROTEIN
Deposited on 1999-12-30, released 2000-01-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Concanavalin-Br
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55915 (0-236)
      • conflict (57)
      • conflict (69)
      • conflict (150)
      • conflict (154)
    Domains in SCOPe 2.08: d1dq5a_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dq5A (A:)
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan