PDB entry 1dox

View 1dox on RCSB PDB site
Description: 1h and 15n sequential assignment, secondary structure and tertiary fold of [2fe-2s] ferredoxin from synechocystis sp. pcc 6803
Deposited on 1995-09-14, released 1996-03-08
The last revision prior to the SCOP 1.61 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: NMR3
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d1dox__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dox_ (-)
  asytvklitpdgessiecsddtyildaaeeagldlpyscragacstcagkitagsvdqsd
  qsfldddqieagyvltcvayptsdctiethkeedly