PDB entry 1doi

View 1doi on RCSB PDB site
Description: 2fe-2s ferredoxin from haloarcula marismortui
Class: electron transport
Keywords: halophilic protein, redox protein, iron-sulfur, electron transport
Deposited on 1996-04-08, released 1996-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2fe-2s ferredoxin
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1doia_
  • Heterogens: K, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1doiA (A:)
    ptveylnyevvddngwdmydddvfgeasdmdlddedygslevnegeyileaaeaqgydwp
    fscragacancaaivlegdidmdmqqilsdeevedknvrltcigspdadevkivynakhl
    dylqnrvi