PDB entry 1dn2

View 1dn2 on RCSB PDB site
Description: fc fragment of human igg1 in complex with an engineered 13 residue peptide dcawhlgelvwct-nh2
Class: immune system
Keywords: Fc IgG Phage Display Peptide, IMMUNE SYSTEM
Deposited on 1999-12-15, released 2000-05-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.194
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin lambda heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB CAA75032 (0-206)
      • conflict (33)
    Domains in SCOPe 2.05: d1dn2a1, d1dn2a2
  • Chain 'B':
    Compound: immunoglobulin lambda heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB CAA75032 (0-206)
      • conflict (33)
    Domains in SCOPe 2.05: d1dn2b1, d1dn2b2
  • Chain 'E':
    Compound: engineered peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1DN2 (0-End)
  • Chain 'F':
    Compound: engineered peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1DN2 (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dn2A (A:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshenpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsre
    emtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dn2B (B:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshenpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsre
    emtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.