PDB entry 1dn2

View 1dn2 on RCSB PDB site
Description: fc fragment of human igg1 in complex with an engineered 13 residue peptide dcawhlgelvwct-nh2
Class: immune system
Keywords: Fc IgG Phage Display Peptide, IMMUNE SYSTEM
Deposited on 1999-12-15, released 2000-05-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.194
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: immunoglobulin lambda heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • GB CAA75032 (0-206)
    • conflict (33)
  Domains in SCOPe 2.03: d1dn2a1, d1dn2a2
• Chain 'B':
  Compound: immunoglobulin lambda heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • GB CAA75032 (0-206)
    • conflict (33)
  Domains in SCOPe 2.03: d1dn2b1, d1dn2b2
• Chain 'E':
  Compound: engineered peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1DN2 (0-End)
• Chain 'F':
  Compound: engineered peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1DN2 (0-End)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dn2A (A:)
  gpsvflfppkpkdtlmisrtpevtcvvvdvshenpevkfnwyvdgvevhnaktkpreeqy
  nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsre
  emtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
  wqqgnvfscsvmhealhnhytqkslsl
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dn2B (B:)
  gpsvflfppkpkdtlmisrtpevtcvvvdvshenpevkfnwyvdgvevhnaktkpreeqy
  nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsre
  emtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
  wqqgnvfscsvmhealhnhytqkslsl
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.