PDB entry 1dn0

View 1dn0 on RCSB PDB site
Description: structure of the fab fragment from a human igm cold agglutinin
Class: immune system
Keywords: fab, igm, antibody, cold agglutinin, human, immune system
Deposited on 1999-12-15, released 2001-01-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.18
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igm-kappa cold agglutinin (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PIR A23746 (0-214)
      • conflict (22)
      • conflict (88)
      • conflict (214)
    Domains in SCOPe 2.06: d1dn0a1, d1dn0a2
  • Chain 'B':
    Compound: igm-kappa cold agglutinin (heavy chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PIR B23746 (1-End)
      • conflict (0)
    Domains in SCOPe 2.06: d1dn0b1, d1dn0b2
  • Chain 'C':
    Compound: igm-kappa cold agglutinin (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PIR A23746 (0-214)
      • conflict (22)
      • conflict (88)
      • conflict (214)
    Domains in SCOPe 2.06: d1dn0c1, d1dn0c2
  • Chain 'D':
    Compound: igm-kappa cold agglutinin (heavy chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PIR B23746 (1-End)
      • conflict (0)
      • conflict (199)
    Domains in SCOPe 2.06: d1dn0d1, d1dn0d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dn0A (A:)
    eivltqspatlslspgeratlscgasqsvssnylawyqqkpgqaprlliydassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygsspltfgggtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dn0B (B:)
    evqlqqwgagllkpsetlsltcavyggsfsdyywswirqppgkglewigeinhsgstnyn
    pslksrvtisvdtsknqfslklssvtaadtavyycarpphdtsghywnywgqgtlvtvss
    gsasaptlfplvscenspsdtssvavgclaqdflpdsitfswkyknnsdisstrgfpsvl
    rggkyaatsqvllpskdvmagtdehvvckvqhpngnkeknvplpviaelppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dn0B (B:)
    evqlqqwgagllkpsetlsltcavyggsfsdyywswirqppgkglewigeinhsgstnyn
    pslksrvtisvdtsknqfslklssvtaadtavyycarpphdtsghywnywgqgtlvtvss
    gsasaptlfplvsctssvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggkya
    atsqvllpskdvtdehvvckvqhpngnkeknvplpv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dn0C (C:)
    eivltqspatlslspgeratlscgasqsvssnylawyqqkpgqaprlliydassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygsspltfgggtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dn0D (D:)
    evqlqqwgagllkpsetlsltcavyggsfsdyywswirqppgkglewigeinhsgstnyn
    pslksrvtisvdtsknqfslklssvtaadtavyycarpphdtsghywnywgqgtlvtvss
    gsasaptlfplvscenspsdtssvavgclaqdflpdsitfswkyknnsdisstrgfpsvl
    rggkyaatsqvllpskdvmagtdehvvckvqhpngnkeknvplpviaelppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dn0D (D:)
    evqlqqwgagllkpsetlsltcavyggsfsdyywswirqppgkglewigeinhsgstnyn
    pslksrvtisvdtsknqfslklssvtaadtavyycarpphdtsghywnywgqgtlvtvss
    gsasaptlfplvscsvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggkyaat
    sqvllpskdvmagtdehvvckvqhpngnkeknvplpv