PDB entry 1dn0

View 1dn0 on RCSB PDB site
Description: structure of the fab fragment from a human igm cold agglutinin
Deposited on 1999-12-15, released 2001-01-24
The last revision prior to the SCOP 1.55 freeze date was dated 2001-01-24, with a file datestamp of 2001-01-24.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.18
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dn0A (A:)
    eivltqspatlslspgeratlscgasqsvssnylawyqqkpgqaprlliydassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygsspltfgggtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dn0B (B:)
    evqlqqwgagllkpsetlsltcavyggsfsdyywswirqppgkglewigeinhsgstnyn
    pslksrvtisvdtsknqfslklssvtaadtavyycarpphdtsghywnywgqgtlvtvss
    gsasaptlfplvscenspsdtssvavgclaqdflpdsitfswkyknnsdisstrgfpsvl
    rggkyaatsqvllpskdvmagtdehvvckvqhpngnkeknvplpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dn0B (B:)
    evqlqqwgagllkpsetlsltcavyggsfsdyywswirqppgkglewigeinhsgstnyn
    pslksrvtisvdtsknqfslklssvtaadtavyycarpphdtsghywnywgqgtlvtvss
    gsasaptlfplvsctssvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggkya
    atsqvllpskdvtdehvvckvqhpngnkeknvplpv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dn0C (C:)
    eivltqspatlslspgeratlscgasqsvssnylawyqqkpgqaprlliydassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygsspltfgggtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dn0D (D:)
    evqlqqwgagllkpsetlsltcavyggsfsdyywswirqppgkglewigeinhsgstnyn
    pslksrvtisvdtsknqfslklssvtaadtavyycarpphdtsghywnywgqgtlvtvss
    gsasaptlfplvscenspsdtssvavgclaqdflpdsitfswkyknnsdisstrgfpsvl
    rggkyaatsqvllpskdvmagtdehvvckvqhpngnkeknvplpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dn0D (D:)
    evqlqqwgagllkpsetlsltcavyggsfsdyywswirqppgkglewigeinhsgstnyn
    pslksrvtisvdtsknqfslklssvtaadtavyycarpphdtsghywnywgqgtlvtvss
    gsasaptlfplvscsvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggkyaat
    sqvllpskdvmagtdehvvckvqhpngnkeknvplpv