PDB entry 1dmy

View 1dmy on RCSB PDB site
Description: complex between murine mitochondrial carbonic anyhdrase v and the transition state analogue acetazolamide
Class: lyase (oxo-acid)
Keywords: proton transfer, lyase (oxo-acid)
Deposited on 1995-10-04, released 1996-04-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.17
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: murine carbonic anhydrase v
    Species: Mus musculus [TaxId:10090]
    Gene: MCA5C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23589 (3-End)
      • variant (163)
      • variant (203)
    Domains in SCOPe 2.03: d1dmya_
  • Chain 'B':
    Compound: murine carbonic anhydrase v
    Species: Mus musculus [TaxId:10090]
    Gene: MCA5C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23589 (3-End)
      • variant (163)
      • variant (203)
    Domains in SCOPe 2.03: d1dmyb_
  • Heterogens: ZN, AZM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dmyA (A:)
    catgtrqspiniqwkdsvydpqlaplrvsydaascrylwntgyffqvefddscedsgisg
    gplgnhyrlkqfhfhwgatdewgsehavdghtypaelhlvhwnstkyenykkasvgengl
    avigvflklgahhqalqklvdvlpevrhkdtqvamgpfdpsclmpacrdywtypgslttp
    plaesvtwivqktpvevspsqlsmfrtllfsgrgeeedvmvnnyrplqplrdrklrssfr
    ldrtkmrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dmyA (A:)
    gtrqspiniqwkdsvydpqlaplrvsydaascrylwntgyffqvefddscedsgisggpl
    gnhyrlkqfhfhwgatdewgsehavdghtypaelhlvhwnstkyenykkasvgenglavi
    gvflklgahhqalqklvdvlpevrhkdtqvamgpfdpsclmpacrdywtypgslttppla
    esvtwivqktpvevspsqlsmfrtllfsgrgeeedvmvnnyrplqplrdrklrssfr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dmyB (B:)
    catgtrqspiniqwkdsvydpqlaplrvsydaascrylwntgyffqvefddscedsgisg
    gplgnhyrlkqfhfhwgatdewgsehavdghtypaelhlvhwnstkyenykkasvgengl
    avigvflklgahhqalqklvdvlpevrhkdtqvamgpfdpsclmpacrdywtypgslttp
    plaesvtwivqktpvevspsqlsmfrtllfsgrgeeedvmvnnyrplqplrdrklrssfr
    ldrtkmrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dmyB (B:)
    gtrqspiniqwkdsvydpqlaplrvsydaascrylwntgyffqvefddscedsgisggpl
    gnhyrlkqfhfhwgatdewgsehavdghtypaelhlvhwnstkyenykkasvgenglavi
    gvflklgahhqalqklvdvlpevrhkdtqvamgpfdpsclmpacrdywtypgslttppla
    esvtwivqktpvevspsqlsmfrtllfsgrgeeedvmvnnyrplqplrdrklrssfr