PDB entry 1dmo

View 1dmo on RCSB PDB site
Description: calmodulin, nmr, 30 structures
Class: calcium-binding protein
Keywords: calcium-induced conformational change, calcium-binding protein
Deposited on 1996-04-24, released 1996-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Xenopus laevis [TaxId:8355]
    Gene: XENOPUS LAEVIS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dmoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dmoA (A:)
    adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
    gtidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdee
    vdemireanidgdgqvnyeefvqmmtak