PDB entry 1dlw

View 1dlw on RCSB PDB site
Description: x-ray crystal structure of truncated hemoglobin from p.caudatum.
Deposited on 1999-12-13, released 2000-09-20
The last revision prior to the SCOP 1.65 freeze date was dated 2000-09-20, with a file datestamp of 2000-09-20.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.133
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1dlwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dlwA (A:)
    slfeqlggqaavqavtaqfyaniqadatvatffngidmpnqtnktaaflcaalggpnawt
    grnlkevhanmgvsnaqfttvighlrsaltgagvaaalveqtvavaetvrgdvvtv