PDB entry 1dlk

View 1dlk on RCSB PDB site
Description: crystal structure analysis of delta-chymotrypsin bound to a peptidyl chloromethyl ketone inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: Delta-chymotrypsin, peptidic inhibior, chloromethyl ketone, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1999-12-10, released 2000-05-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: 0.206
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Thrombin light chain
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00766 (0-12)
  Domains in SCOPe 2.06: d1dlk.1
• Chain 'B':
  Compound: Thrombin heavy chain
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00766 (0-229)
  Domains in SCOPe 2.06: d1dlk.1
• Chain 'C':
  Compound: Thrombin light chain
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00766 (0-12)
  Domains in SCOPe 2.06: d1dlk.2
• Chain 'D':
  Compound: Thrombin heavy chain
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00766 (0-229)
  Domains in SCOPe 2.06: d1dlk.2
• Chain 'E':
  Compound: peptidic inhibitor
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1DLK (0-4)
• Chain 'F':
  Compound: peptidic inhibitor
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1DLK (0-4)
• Heterogens: CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dlkA (A:)
  cgvpaiqpvlsgl
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dlkB (B:)
  ivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsdvvvagefdqgs
  ssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclpsasddfaagtt
  cvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdamicagasgvsscmgds
  ggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dlkC (C:)
  cgvpaiqpvlsgl
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dlkD (D:)
  ivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsdvvvagefdqgs
  ssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclpsasddfaagtt
  cvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdamicagasgvsscmgds
  ggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.