PDB entry 1dlh

View 1dlh on RCSB PDB site
Description: crystal structure of the human class II MHC protein hla-dr1 complexed with an influenza virus peptide
Class: histocompatibility antigen
Keywords: histocompatibility antigen
Deposited on 1994-02-15, released 1994-06-22
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.205
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: class II histocompatibility antigen (hla-dr1) (alpha chain)
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1dlha1, d1dlha2
  • Chain 'B':
    Compound: class II histocompatibility antigen (hla-dr1) (beta chain)
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1dlhb1, d1dlhb2
  • Chain 'C':
    Compound: enterotoxin type b precursor
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: class II histocompatibility antigen (hla-dr1) (alpha chain)
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1dlhd1, d1dlhd2
  • Chain 'E':
    Compound: class II histocompatibility antigen (hla-dr1) (beta chain)
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1dlhe1, d1dlhe2
  • Chain 'F':
    Compound: enterotoxin type b precursor
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, NDG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dlhA (A:)
    eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
    iavdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtwl
    rngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefda
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dlhB (B:)
    trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn
    sqkdlleqrraavdtycrhnygvgesftvqrrvepkvtvypsktqplqhhnllvcsvsgf
    ypgsievrwfrngqeekagvvstgliqngdwtfqtlvmletvprsgevytcqvehpsvts
    pltvewra
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dlhD (D:)
    eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
    iavdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtwl
    rngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefda
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dlhE (E:)
    trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn
    sqkdlleqrraavdtycrhnygvgesftvqrrvepkvtvypsktqplqhhnllvcsvsgf
    ypgsievrwfrngqeekagvvstgliqngdwtfqtlvmletvprsgevytcqvehpsvts
    pltvewra
    

  • Chain 'F':
    No sequence available.