PDB entry 1dlh

View 1dlh on RCSB PDB site
Description: crystal structure of the human class ii mhc protein hla-dr1 complexed with an influenza virus peptide
Deposited on 1994-02-15, released 1994-06-22
The last revision prior to the SCOP 1.55 freeze date was dated 1994-06-22, with a file datestamp of 1994-06-24.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.205
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dlhA (A:)
    eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
    iavdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtwl
    rngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefda
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dlhB (B:)
    trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn
    sqkdlleqrraavdtycrhnygvgesftvqrrvepkvtvypsktqplqhhnllvcsvsgf
    ypgsievrwfrngqeekagvvstgliqngdwtfqtlvmletvprsgevytcqvehpsvts
    pltvewra
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dlhD (D:)
    eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
    iavdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtwl
    rngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefda
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dlhE (E:)
    trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn
    sqkdlleqrraavdtycrhnygvgesftvqrrvepkvtvypsktqplqhhnllvcsvsgf
    ypgsievrwfrngqeekagvvstgliqngdwtfqtlvmletvprsgevytcqvehpsvts
    pltvewra