PDB entry 1dlf

View 1dlf on RCSB PDB site
Description: high resolution crystal structure of the fv fragment from an anti-dansyl switch variant antibody igg2a(s) crystallized at ph 5.25
Deposited on 1998-07-14, released 1999-07-26
The last revision prior to the SCOP 1.61 freeze date was dated 1999-07-26, with a file datestamp of 1999-07-25.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.183
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Domains in SCOP 1.61: d1dlfh_
  • Chain 'L':
    Domains in SCOP 1.61: d1dlfl_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dlfH (H:)
    evkleesggglvqpggsmklscatsgftfsdawmdwvrqspekglewvaeirnkannhat
    yyaesvkgrftisrddskrrvylqmntlraedtgiyyctgiyyhypwfaywgqgtlvtvs
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dlfL (L:)
    dvvmtqtplslpvslgnqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtkleikr