PDB entry 1dlb

View 1dlb on RCSB PDB site
Description: helical interactions in the hiv-1 gp41 core reveals structural basis for the inhibitory activity of gp41 peptides
Deposited on 1999-12-09, released 1999-12-15
The last revision prior to the SCOP 1.65 freeze date was dated 2000-04-02, with a file datestamp of 2000-04-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1dlba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1dlbA (A:)
sgivqqqnnllraieaqqhllqltvwgikqlqarsggrggwmewdreinnytslihslie
esqnlqek

    Sequence, based on observed residues (ATOM records): (download) 
    >1dlbA (A:)
givqqqnnllraieaqqhllqltvwgikqlqarsrggwmewdreinnytslihslieesq
nlq