PDB entry 1dky

View 1dky on RCSB PDB site
Description: the substrate binding domain of dnak in complex with a substrate peptide, determined from type 2 native crystals
Deposited on 1996-06-03, released 1996-12-07
The last revision prior to the SCOP 1.65 freeze date was dated 1996-12-07, with a file datestamp of 1996-12-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.225
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1dkya_
  • Chain 'B':
    Domains in SCOP 1.65: d1dkyb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dkyA (A:)
    vllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavsihvlqgerkra
    adnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassgln
    edeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaiesa
    ltaletalkgedkaaieakmqelaqvsqklmeiaqqqha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dkyA (A:)
    vllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavsihvlqgerkra
    adnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassgln
    edeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaiesa
    ltaletalkgedkaaieakmqelaqvsqklm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dkyB (B:)
    vllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavsihvlqgerkra
    adnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassgln
    edeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaiesa
    ltaletalkgedkaaieakmqelaqvsqklmeiaqqqha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dkyB (B:)
    vllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavsihvlqgerkra
    adnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassgln
    edeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaiesa
    ltaletalkgedkaaieakmqel