PDB entry 1dkv

View 1dkv on RCSB PDB site
Description: the crystal structure of calcium-free human m-calpain
Class: hydrolase
Keywords: m-calpain, calcium, papain-like
Deposited on 1999-12-08, released 2000-01-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2001-12-07, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.206
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: m-calpain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04632 (Start-699)
      • conflict (210)
      • conflict (295)
      • conflict (445)
    Domains in SCOPe 2.06: d1dkva4, d1dkva5, d1dkva6
  • Chain 'B':
    Compound: calpain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • GB NP_001740 (0-183)
    Domains in SCOPe 2.06: d1dkvb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dkvA (A:)
    magiaaklakdreaaeglgsheraikylnqdyealrnecleagtlfqdpsfpaipsalgf
    kelgpyssktrgmrwkrpteicadpqfiiggatrtdicqgalgdcwllaaiasltlneei
    larvvplnqsfqenyagifhfqfwqygewvevvvddrlptkdgellfvhsaegsefwsal
    lekayakingcyealsggattegfedftgglaewyelkkpppnlfkiiqkalqkgsllgc
    siditsaadseaitfqklvkghaysvtgaeevesngslqklirirnpwgevewtgawndn
    cpswntidpeererltrrhedgefwmsfsdflrhysrleicnltpdtltsdtykkwkltk
    mdgnwrrgstaggcrnypntfwmnpqylikleeededeedgesgctflvgliqkhrrrqr
    kmgedmhtigfgiyevpeelsgqtnlhlsknffltnrarersdtfinlrevlnrfklppg
    eyilvpstfepnkdgdfcirvfsekkadyqavddeieanleefdiseddiddgvrrlfaq
    lagedaeisafelqtilrrvlakrqdiksdgfsietckimvdmldsdgsgklglkefyil
    wtkiqkyqkiyreidvdrsgtmnsyemrkaleeagfkmpcqlhqvivarfaddqliidfd
    nfvrclvrletlfkifkqldpentgtieldliswlcfsvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dkvA (A:)
    agiaaklakdreaaeglgsheraikylnqdyealrnecleagtlfqdpsfpaipsalgfk
    elgpyssktrgmrwkrpteicadpqfiiggatrtdicqgalgdcwllaaiasltlneeil
    arvvplnqsfqenyagifhfqfwqygewvevvvddrlptkdgellfvhsaegsefwsall
    ekayakingcyealsggattegfedftgglaewyelkkpppnlfkiiqkalqkgsllgcs
    iditsaadseaitfqklvkghaysvtgaeevesngslqklirirnpwgevewtgawndnc
    pswntidpeererltrrhedgefwmsfsdflrhysrleicnltpdtltsdtykkwkltkm
    dgnwrrgstaggcrnypntfwmnpqylikleeededeedgesgctflvgliqkhrrrqrk
    mgedmhtigfgiyevpeelsgqtnlhlsknffltnrarersdtfinlrevlnrfklppge
    yilvpstfepnkdgdfcirvfsekkadyqavddeieanleefdiseddiddgvrrlfaql
    agedaeisafelqtilrrvlakrqdiksdgfsietckimvdmldsdgsgklglkefyilw
    tkiqkyqkiyreidvdrsgtmnsyemrkaleeagfkmpcqlhqvivarfaddqliidfdn
    fvrclvrletlfkifkqldpentgtieldliswlcfsvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dkvB (B:)
    thysnieaneseevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtc
    rsmvavmdsdttgklgfeefkylwnnikrwqaiykqfdtdrsgticsselpgafeaagfh
    lnehlynmiirrysdesgnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlql
    tmys