PDB entry 1dkk

View 1dkk on RCSB PDB site
Description: bobwhite quail lysozyme with nitrate
Class: hydrolase (o-glycosyl)
Keywords: hydrolase, glycosidase, bacteriolytic enzyme
Deposited on 1996-01-10, released 1996-07-11
The last revision prior to the SCOP 1.73 freeze date was dated 1996-07-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.157
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Colinus virginianus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1dkka_
  • Chain 'B':
    Compound: lysozyme
    Species: Colinus virginianus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1dkkb_
  • Heterogens: NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dkkA (A:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins
    rwwcndgktpgsrnlcnipcsallssditatvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dkkB (B:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins
    rwwcndgktpgsrnlcnipcsallssditatvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl