PDB entry 1dkd

View 1dkd on RCSB PDB site
Description: crystal structure of a groel (apical domain) and a dodecameric peptide complex
Deposited on 1999-12-07, released 2000-01-12
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-12, with a file datestamp of 2000-01-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.215
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dkda_
  • Chain 'B':
    Domains in SCOP 1.55: d1dkdb_
  • Chain 'C':
    Domains in SCOP 1.55: d1dkdc_
  • Chain 'D':
    Domains in SCOP 1.55: d1dkdd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dkdA (A:)
    egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
    aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
    katledlgqakrvvinkdtttiidgv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dkdB (B:)
    egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
    aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
    katledlgqakrvvinkdtttiidgv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dkdC (C:)
    egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
    aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
    katledlgqakrvvinkdtttiidgv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dkdD (D:)
    egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
    aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
    katledlgqakrvvinkdtttiidgv