PDB entry 1dkd

View 1dkd on RCSB PDB site
Description: crystal structure of a groEL (apical domain) and a dodecameric peptide complex
Class: chaperone
Keywords: molecular chaperon, hsp60, protein folding, peptide selection, phage display, peptide binding groove formed by paired helices substrate peptide in beta-sheet, chaperone
Deposited on 1999-12-07, released 2000-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.215
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: groEL
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dkda_
  • Chain 'B':
    Compound: groEL
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dkdb_
  • Chain 'C':
    Compound: groEL
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dkdc_
  • Chain 'D':
    Compound: groEL
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dkdd_
  • Chain 'E':
    Compound: 12-mer peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1DKD (Start-11)
  • Chain 'F':
    Compound: 12-mer peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1DKD (Start-11)
  • Chain 'G':
    Compound: 12-mer peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1DKD (0-11)
  • Chain 'H':
    Compound: 12-mer peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1DKD (Start-11)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dkdA (A:)
    egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
    aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
    katledlgqakrvvinkdtttiidgv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dkdB (B:)
    egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
    aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
    katledlgqakrvvinkdtttiidgv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dkdC (C:)
    egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
    aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
    katledlgqakrvvinkdtttiidgv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dkdD (D:)
    egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
    aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
    katledlgqakrvvinkdtttiidgv
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.