PDB entry 1dk4

View 1dk4 on RCSB PDB site
Description: crystal structure of mj0109 gene product inositol monophosphatase
Class: hydrolase
Keywords: homodimer, complexed with zn and pi, hydrolase
Deposited on 1999-12-06, released 2000-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.243
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inositol monophosphatase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dk4a_
  • Chain 'B':
    Compound: inositol monophosphatase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dk4b_
  • Heterogens: ZN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dk4A (A:)
    mkwdeigkniakeiekeilpyfgrkdksyvvgtspsgdeteifdkisedialkylkslnv
    nivseelgvidnssewtvvidpidgsfnfingipffafcfgvfknnepyygltyefltks
    fyeaykgkgaylngrkikvkdfnpnnivisyypskkidleklrnkvkrvrifgafglemc
    yvakgtldavfdvrpkvravdiassyiickeagalitdengdelkfdlnatdrlniivan
    skemldiildll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dk4B (B:)
    mkwdeigkniakeiekeilpyfgrkdksyvvgtspsgdeteifdkisedialkylkslnv
    nivseelgvidnssewtvvidpidgsfnfingipffafcfgvfknnepyygltyefltks
    fyeaykgkgaylngrkikvkdfnpnnivisyypskkidleklrnkvkrvrifgafglemc
    yvakgtldavfdvrpkvravdiassyiickeagalitdengdelkfdlnatdrlniivan
    skemldiildll