PDB entry 1dk3

View 1dk3 on RCSB PDB site
Description: refined solution structure of the n-terminal domain of DNA polymerase beta
Class: transferase
Keywords: DNA-binding, deoxyribose 5'-phosphate lyase, nucleotidyltransferase
Deposited on 1999-12-06, released 2000-02-14
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-07-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA polymerase beta
  Species: Rattus norvegicus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06766 (0-86)
  Domains in SCOP 1.73: d1dk3a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dk3A (A:)
  mskrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeak
  klpgvgtkiaekideflatgklrklek