PDB entry 1dk2

View 1dk2 on RCSB PDB site
Description: refined solution structure of the n-terminal domain of dna polymerase beta
Deposited on 1999-12-06, released 2000-02-14
The last revision prior to the SCOP 1.67 freeze date was dated 2000-02-14, with a file datestamp of 2000-02-14.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1dk2a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dk2A (A:)
  skrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakk
  lpgvgtkiaekideflatgklrklek