PDB entry 1dk1

View 1dk1 on RCSB PDB site
Description: detailed view of a key element of the ribosome assembly: crystal structure of the s15-rRNA complex
Class: ribosome
Keywords: ribosome, s15, protein, RNA
Deposited on 1999-12-06, released 2000-04-02
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.213
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30S ribosomal protein S15
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80378 (0-85)
      • engineered (10)
      • engineered (78)
      • engineered (56-57)
    Domains in SCOPe 2.01: d1dk1a_
  • Chain 'B':
    Compound: rRNA fragment
    Species: Thermus thermophilus [TaxId:274]
  • Heterogens: MG, NA, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dk1A (A:)
    pitkeekqkvmqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
    qrrrllrylqredperyrmlieklgi
    

  • Chain 'B':
    No sequence available.