PDB entry 1dik

View 1dik on RCSB PDB site
Description: pyruvate phosphate dikinase
Deposited on 1995-12-06, released 1996-04-03
The last revision prior to the SCOP 1.71 freeze date was dated 1996-04-03, with a file datestamp of 1996-04-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.182
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1dik_ (-)
    makwvykfeegnasmrnllggkgcnlaemtilgmpipqgftvtteacteyynsgkqitqe
    iqdqifeaitwleelngkkfgdtedpllvsvrsaarasmpgmmdtilnlglndvavegfa
    kktgnprfaydsyrrfiqmysdvvmevpkshfekiidamkeekgvhfdtdltaddlkela
    ekfkavykeamngeefpqepkdqlmgavkavfrswdnpraivyrrmndipgdwgtavnvq
    tmvfgnkgetsgtgvaftrnpstgekgiygeylinaqgedvvagvrtpqpitqlendmpd
    cykqfmdlamklekhfrdmqdmeftieegklyflqtrngkrtapaalqiacdlvdegmit
    eeeavvrieaksldqllhptfnpaalkagevigsalpaspgaaagkvyftadeakaahek
    gervilvrletspediegmhaaegiltvrggmtshaavvargmgtccvsgcgeikineea
    ktfelgghtfaegdyisldgstgkiykgdietqeasvsgsferimvwadkfrtlkvrtna
    dtpedtlnavklgaegiglcrtehmffeadrimkirkmilsdsveareealnelipfqkg
    dfkamykalegrpmtvryldpplhefvphteeeqaelaknmgltlaevkakvdelhefnp
    mmghrgcrlavtypeiakmqtravmeaaievkeetgidivpeimiplvgekkelkfvkdv
    vvevaeqvkkekgsdmqyhigtmieipraaltadaiaeeaeffsfgtndltqmtfgfsrd
    dagkfldsyykakiyesdpfarldqtgvgqlvemavkkgrqtrpglkcgicgehggdpss
    vefchkvglnyvscspfrvpiarlaaaqaalnnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dik_ (-)
    akwvykfeegnasmrnllggkgcnlaemtilgmpipqgftvtteacteyynsgkqitqei
    qdqifeaitwleelngkkfgdtedpllvsvrsaarasmpgmmdtilnlglndvavegfak
    ktgnprfaydsyrrfiqmysdvvmevpkshfekiidamkeekgvhfdtdltaddlkelae
    kfkavykeamngeefpqepkdqlmgavkavfrswdnpraivyrrmndipgdwgtavnvqt
    mvfgnkgetsgtgvaftrnpstgekgiygeylinaqgedvvagvrtpqpitqlendmpdc
    ykqfmdlamklekhfrdmqdmeftieegklyflqtrngkrtapaalqiacdlvdegmite
    eeavvrieaksldqllhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekg
    ervilvrletspediegmhaaegiltvrggmtshaavvargmgtccvsgcgeikineeak
    tfelgghtfaegdyisldgstgkiietqeasvsgsferimvwadkfrtlkvrtnadtped
    tlnavklgaegiglcrtehmffeadrimkirkmilsdsveareealnelipfqkgdfkam
    ykalegrpmtvryldpplhefvphteeeqaelaknmgltlaevkakvdelhefnpmmghr
    gcrlavtypeiakmqtravmeaaievkeetgidivpeimiplvgekkelkfvkdvvveva
    eqvkkekgsdmqyhigtmieipraaltadaiaeeaeffsfgtndltqmtfgfsrddagkf
    ldsyykakiyesdpfarldqtgvgqlvemavkkgrqtrpglkcgicgehggdpssvefch
    kvglnyvscspfrvpiarlaaaqaalnnk