PDB entry 1dii

View 1dii on RCSB PDB site
Description: crystal structure of p-cresol methylhydroxylase at 2.5 a resolution
Class: oxidoreductase
Keywords: flavocytochrome, electron-transfer, fad, heme, oxidoreductase
Deposited on 1999-11-29, released 1999-12-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.172
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p-cresol methylhydroxylase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1diia1, d1diia2
  • Chain 'B':
    Compound: p-cresol methylhydroxylase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1diib1, d1diib2
  • Chain 'C':
    Compound: p-cresol methylhydroxylase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1diic_
  • Chain 'D':
    Compound: p-cresol methylhydroxylase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1diid_
  • Heterogens: CL, FAD, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1diiA (A:)
    mseqnnavlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsa
    avtattveqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikid
    pemcyalvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfm
    mqcgmevvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmp
    kppvfkpfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqytte
    pghtpdsvikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeag
    dtqpfkyraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhky
    gldyvaefivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfq
    drvaqsygpvkrklehaikravdpnnilapgrsgidlnndf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1diiA (A:)
    avlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaavtatt
    veqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidpemcya
    lvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmmqcgme
    vvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpkppvfk
    pfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttepghtpd
    svikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagdtqpfk
    yraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkygldyva
    efivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqdrvaqs
    ygpvkrklehaikravdpnnilapgrsgidlnndf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1diiB (B:)
    mseqnnavlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsa
    avtattveqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikid
    pemcyalvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfm
    mqcgmevvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmp
    kppvfkpfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqytte
    pghtpdsvikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeag
    dtqpfkyraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhky
    gldyvaefivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfq
    drvaqsygpvkrklehaikravdpnnilapgrsgidlnndf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1diiB (B:)
    avlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaavtatt
    veqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidpemcya
    lvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmmqcgme
    vvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpkppvfk
    pfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttepghtpd
    svikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagdtqpfk
    yraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkygldyva
    efivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqdrvaqs
    ygpvkrklehaikravdpnnilapgrsgidlnndf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1diiC (C:)
    dsqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdd
    esltqvaeylsslpapaaqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1diiC (C:)
    sqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdde
    sltqvaeylsslp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1diiD (D:)
    dsqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdd
    esltqvaeylsslpapaaqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1diiD (D:)
    sqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdde
    sltqvaeylsslp