PDB entry 1di3

View 1di3 on RCSB PDB site
Description: role of amino acid residues at turns in the conformational stability and folding of human lysozyme
Deposited on 1999-11-28, released 1999-12-08
The last revision prior to the SCOP 1.59 freeze date was dated 2000-08-23, with a file datestamp of 2000-08-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1di3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1di3A (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdgstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv