PDB entry 1dgw

View 1dgw on RCSB PDB site
Description: Structure of the rhombohedral crystal of canavalin from jack bean
Class: plant protein
Keywords: duplicated swiss-roll beta barrels, loops with alpha helices, merohedral/ hemihedral twinning
Deposited on 1999-11-26, released 1999-12-20
The last revision prior to the SCOP 1.75 freeze date was dated 2005-05-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.189
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: canavalin
    Species: Canavalia ensiformis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1dgwa_
  • Chain 'X':
    Compound: canavalin
    Species: Canavalia ensiformis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1dgw.1
  • Chain 'Y':
    Compound: canavalin
    Species: Canavalia ensiformis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1dgw.1
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dgwA (A:)
    nnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphhsd
    sdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfait
    frrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmp
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1dgwX (X:)
    dkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsratvi
    lvanegraevelvgleqqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dgwX (X:)
    dkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsratvi
    lvanegraevelvgle
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1dgwY (Y:)
    mqlrryaatlsegdiivipssfpvalkaasdlnmvgigvnaennernflaghkenvirqi
    prqvsdltfpgsgeeveellenqkesyfvdgqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dgwY (Y:)
    qlrryaatlsegdiivipssfpvalkaasdlnmvgigvnaennernflaghkenvirqip
    rqvsdltfpgsgeeveellenqkesyfvdgqp