PDB entry 1dgw

View 1dgw on RCSB PDB site
Description:
Deposited on 1999-11-26, released 1999-12-20
The last revision prior to the SCOP 1.71 freeze date was dated 1999-12-20, with a file datestamp of 1999-12-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.189
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1dgwa_
  • Chain 'X':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1dgw.1
  • Chain 'Y':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1dgw.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dgwA (A:)
    nnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphhsd
    sdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfait
    frrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmp
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1dgwX (X:)
    dkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsratvi
    lvanegraevelvgleqqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dgwX (X:)
    dkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsratvi
    lvanegraevelvgle
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1dgwY (Y:)
    mqlrryaatlsegdiivipssfpvalkaasdlnmvgigvnaennernflaghkenvirqi
    prqvsdltfpgsgeeveellenqkesyfvdgqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dgwY (Y:)
    qlrryaatlsegdiivipssfpvalkaasdlnmvgigvnaennernflaghkenvirqip
    rqvsdltfpgsgeeveellenqkesyfvdgqp