PDB entry 1dgt

View 1dgt on RCSB PDB site
Description: crystal structure of nad+-dependent dna ligase
Deposited on 1999-11-25, released 2000-11-27
The last revision prior to the SCOP 1.65 freeze date was dated 2000-11-27, with a file datestamp of 2000-11-27.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.254
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dgtA (A:)
    mtreearrrinelrdliryhnyryyvladpeisdaeydrllrelkeleerfpefkspdsp
    teqvgarpleptfrpvrhptrmysldnaftyeevlafeerlereaeapslytvehkvdgl
    svlyyeegvwstgsgdgevgeevtqnlltiptiprrlkgvpdrlevrgevympieaflrl
    neeleergekvfknprnaaagslrqkdprvtakrglratfyalglglgleesglksqyel
    llwlkekgfpvehcyekalgaegveevyrrglaqrhalpfeadgvvlklddltlwgelgy
    taraprfalaykfpaeeketrlldvvfqvgrtgrvtpvgvlepvfiegsevsrvtlhnes
    yieeldirigdwvlvhkaggvipevlrvlkerrtgkerpirwpeacpecghrlvkegkvh
    rcpnplcpakrfeairhyasrkamdieglgeklierllekglvrdvadlyhlrkedllgl
    ermgeksaqnllrqieeskhrglerllyalglpgvgevlarnlarrfgtmdrlleaslee
    lieveevgeltarailetlkdpafrdlvrrlkeagvsmeskeevsdllsgltfvltgels
    rpreevkallgrlgakvtdsvsrktsylvvgenpgsklekaralgvavlteeefwrflke
    kgapvpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dgtA (A:)
    mtreearrrinelrdliryhnyryyvladpeisdaeydrllrelkeleerfpefkspdsp
    teqvgarpleptfrpvrhptrmysldnaftyeevlafeerlereaeapslytvehkvdgl
    svlyyeegvwstgsgdgevgeevtqnlltiptiprrlkgvpdrlevrgevympieaflrl
    neeleergekvfknprnaaagslrqkdprvtakrglratfyalglglgleesglksqyel
    llwlkekgfpvehcyekalgaegveevyrrglaqrhalpfeadgvvlklddltlwgelgy
    taraprfalaykfpaeeketrlldvvfqvgrtgrvtpvgvlepvfiegsevsrvtlhnes
    yieeldirigdwvlvhkaggvipevlrvlkerrtgkerpirwpeacpecghrlvkegkvh
    rcpnplcpakrfeairhyasrkamdieglgeklierllekglvrdvadlyhlrkedllgl
    ermgeksaqnllrqieeskhrglerllyalglpgvgevlarnlarrfgtmdrlleaslee
    lieveevgeltarailetlkdpafrdlvrrlkeagvsmesk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dgtB (B:)
    mtreearrrinelrdliryhnyryyvladpeisdaeydrllrelkeleerfpefkspdsp
    teqvgarpleptfrpvrhptrmysldnaftyeevlafeerlereaeapslytvehkvdgl
    svlyyeegvwstgsgdgevgeevtqnlltiptiprrlkgvpdrlevrgevympieaflrl
    neeleergekvfknprnaaagslrqkdprvtakrglratfyalglglgleesglksqyel
    llwlkekgfpvehcyekalgaegveevyrrglaqrhalpfeadgvvlklddltlwgelgy
    taraprfalaykfpaeeketrlldvvfqvgrtgrvtpvgvlepvfiegsevsrvtlhnes
    yieeldirigdwvlvhkaggvipevlrvlkerrtgkerpirwpeacpecghrlvkegkvh
    rcpnplcpakrfeairhyasrkamdieglgeklierllekglvrdvadlyhlrkedllgl
    ermgeksaqnllrqieeskhrglerllyalglpgvgevlarnlarrfgtmdrlleaslee
    lieveevgeltarailetlkdpafrdlvrrlkeagvsmeskeevsdllsgltfvltgels
    rpreevkallgrlgakvtdsvsrktsylvvgenpgsklekaralgvavlteeefwrflke
    kgapvpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dgtB (B:)
    mtreearrrinelrdliryhnyryyvladpeisdaeydrllrelkeleerfpefkspdsp
    teqvgarpleptfrpvrhptrmysldnaftyeevlafeerlereaeapslytvehkvdgl
    svlyyeegvwstgsgdgevgeevtqnlltiptiprrlkgvpdrlevrgevympieaflrl
    neeleergekvfknprnaaagslrqkdprvtakrglratfyalglglgleesglksqyel
    llwlkekgfpvehcyekalgaegveevyrrglaqrhalpfeadgvvlklddltlwgelgy
    taraprfalaykfpaeeketrlldvvfqvgrtgrvtpvgvlepvfiegsevsrvtlhnes
    yieeldirigdwvlvhkaggvipevlrvlkerrtgkerpirwpeacpecghrlvkegkvh
    rcpnplcpakrfeairhyasrkamdieglgeklierllekglvrdvadlyhlrkedllgl
    ermgeksaqnllrqieeskhrglerllyalglpgvgevlarnlarrfgtmdrlleaslee
    lieveevgeltarailetlkdpafrdlvrrlkeagvsmeskeevsdllsgltfvltgels
    rpreevkallgrlgakvtdsvsrktsylvvgenpgsklekaralgvavlteeefwrflke