PDB entry 1dgq

View 1dgq on RCSB PDB site
Description: nmr solution structure of the inserted domain of human leukocyte function associated antigen-1
Class: immune system
Keywords: rossman fold, immune system
Deposited on 1999-11-24, released 2000-02-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leukocyte function associated antigen-1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20701 (0-187)
      • conflict (0-2)
      • conflict (65)
    Domains in SCOPe 2.03: d1dgqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dgqA (A:)
    maskgnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdf
    sdyvkwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeat
    dsgnidaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelq
    kkiyvieg