PDB entry 1dga

View 1dga on RCSB PDB site
Description: structure of dictyostelium discoideum actin complexed with mg atp and human gelsolin segment 1.
Deposited on 1999-01-29, released 2000-01-29
The last revision prior to the SCOP 1.63 freeze date was dated 2000-01-29, with a file datestamp of 2000-01-29.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.196
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dgaA (A:)
    dvqalvidngsgmckagfagddapravfpsivgrprhtgvmvgmgqkdsyvgdeaqskrg
    iltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqim
    fetfntpamyvaiqavlslyasgrttgivmdsgdgvshtvpiyegyalphailrldlagr
    dltdymmkiltergysftttaereivrdikeklayvaldfeqemataasssaleksyelp
    dgqvitignerfrcpealfqpsflgmesagihettynsimkcdvdirkdlygnvvlsggt
    tmfpgiadrmnkeltalapstmkikiiapperkysvwiggsilaslstfqqmwiskeeyd
    esgpsivhrkcf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dgaA (A:)
    dvqalvidngsgmckagfagddapravfpsivgrprhtgkdsyvgdeaqskrgiltlkyp
    iehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntp
    amyvaiqavlslyasgrttgivmdsgdgvshtvpiyegyalphailrldlagrdltdymm
    kiltergysftttaereivrdikeklayvaldfeqemataasssaleksyelpdgqviti
    gnerfrcpealfqpsflgmesagihettynsimkcdvdirkdlygnvvlsggttmfpgia
    drmnkeltalapstmkikiiapperkysvwiggsilaslstfqqmwiskeeydesgpsiv
    hrkcf
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dgaG (G:)
    vehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlh
    ywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggva
    sgf