PDB entry 1dg7

View 1dg7 on RCSB PDB site
Description: dihydrofolate reductase of mycobacterium tuberculosis complexed with nadph and 4-bromo wr99210
Class: oxidoreductase
Keywords: dihydrofolate reductase, structure-based inhibitor design, folateanalogs, rossmann fold, nicotinamide adenine dinucleotide, wr99210, anti-malaria agent, tuberculosis, oxidoreductase
Deposited on 1999-11-23, released 2000-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.198
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrofolate reductase
  Species: Mycobacterium tuberculosis [TaxId:1773]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A546 (0-158)
  Domains in SCOPe 2.08: d1dg7a_
• Heterogens: WRB, NDP, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dg7A (A:)
  mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr
  rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp
  reagdalapvldetwrgetgewrfsrsglryrlysyhrs