PDB entry 1dg6

View 1dg6 on RCSB PDB site
Description:
Deposited on 1999-11-23, released 2000-01-26
The last revision prior to the SCOP 1.55 freeze date was dated 2000-02-04, with a file datestamp of 2000-02-04.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.141
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1dg6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dg6A (A:)
    qrvaahitgtrgrsntlsspnsknekalgrkinswessrsghsflsnlhlrngelvihek
    gfyyiysqtyfrfqeeikentkndkqmvqyiykytsypapillmksarnscwskdaeygl
    ysiyqggifelkendrifvsvtnehlidmdheasffgaflvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dg6A (A:)
    qrvaahitgtrknekalgrkinswessrsghsflsnlhlrngelvihekgfyyiysqtyf
    rfqekentkndkqmvqyiykytsypapillmksarnscwskdaeyglysiyqggifelke
    ndrifvsvtnehlidmdheasffgaflvg