PDB entry 1dg1

View 1dg1 on RCSB PDB site
Description: whole, unmodified, ef-tu(elongation factor tu).
Class: RNA binding protein
Keywords: elongation factor, tRNA binding, alpha beta shift, ts binding protein, gtpase, GDP binding, RNA binding protein
Deposited on 1999-11-22, released 1999-12-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.168
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: elongation factor tu
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1dg1g1, d1dg1g2, d1dg1g3
  • Chain 'H':
    Compound: elongation factor tu
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1dg1h1, d1dg1h2, d1dg1h3
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1dg1G (G:)
    mskekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekarg
    itintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehi
    llgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkale
    gdaeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvg
    eeveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtik
    phtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmv
    vtlihpiamddglrfaireggrtvgagvvakvls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dg1G (G:)
    kphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshve
    ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp
    yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki
    lelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgik
    etqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfesev
    yilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpiam
    ddglrfaireggrtvgagvvakvls
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1dg1H (H:)
    mskekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekarg
    itintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehi
    llgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkale
    gdaeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvg
    eeveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtik
    phtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmv
    vtlihpiamddglrfaireggrtvgagvvakvls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dg1H (H:)
    kphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshve
    ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp
    yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki
    lelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgik
    etqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfesev
    yilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpiam
    ddglrfaireggrtvgagvvakvls