PDB entry 1dg1

View 1dg1 on RCSB PDB site
Description: whole, unmodified, ef-tu(elongation factor tu).
Deposited on 1999-11-22, released 1999-12-01
The last revision prior to the SCOP 1.55 freeze date was dated 2000-03-29, with a file datestamp of 2000-03-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.172
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dg1G (G:)
    kphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshve
    ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp
    yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki
    lelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgik
    etqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfesev
    yilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpiam
    ddglrfaireggrtvgagvvakvls
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dg1H (H:)
    kphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshve
    ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp
    yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki
    lelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgik
    etqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfesev
    yilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpiam
    ddglrfaireggrtvgagvvakvls