PDB entry 1dfb

View 1dfb on RCSB PDB site
Description: structure of a human monoclonal antibody fab fragment against gp41 of human immunodeficiency virus type i
Deposited on 1992-03-27, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.7 Å
R-factor: 0.177
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dfbH (H:)
    evqlvesggglvqpgrslrlscaasgftfndyamhwvrqapgkglewvsgiswdsssigy
    adsvkgrftisrdnaknslylqmnslraedmalyycvkgrdyydsggyftvafdiwgqgt
    mvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfp
    avlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dfbL (L:)
    diqmtqspstlsasvgdrvtitcrasqsisrwlawyqqkpgkvpklliykasslesgvps
    rfsgsgsgteftltisslqpddfatyycqqynsysfgpgtkvdikrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnrgec