PDB entry 1de2

View 1de2 on RCSB PDB site
Description: nmr structures of reduced bacteriophage t4 glutaredoxin
Deposited on 1999-11-12, released 1999-11-24
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-30, with a file datestamp of 2004-03-30.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1de2a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1de2A (A:)
  mfkvygydsnihkcvycdnakrlltvkkqpfefinimpekgvfddekiaelltklgrdtq
  igltmpqvfapdgshiggfdqlreyfk