PDB entry 1dd8

View 1dd8 on RCSB PDB site
Description: crystal structure of beta-ketoacyl-[acyl carrier protein] synthase I from escherichia coli
Class: transferase
Keywords: thiolase fold, transferase
Deposited on 1999-11-09, released 1999-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.188
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-ketoacyl [acyl carrier protein] synthase I
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A953 (0-405)
      • conflict (3)
    Domains in SCOPe 2.07: d1dd8a1, d1dd8a2
  • Chain 'B':
    Compound: beta-ketoacyl [acyl carrier protein] synthase I
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A953 (0-405)
      • conflict (3)
    Domains in SCOPe 2.07: d1dd8b1, d1dd8b2
  • Chain 'C':
    Compound: beta-ketoacyl [acyl carrier protein] synthase I
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A953 (0-405)
      • conflict (3)
    Domains in SCOPe 2.07: d1dd8c1, d1dd8c2
  • Chain 'D':
    Compound: beta-ketoacyl [acyl carrier protein] synthase I
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A953 (0-405)
      • conflict (3)
    Domains in SCOPe 2.07: d1dd8d1, d1dd8d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dd8A (A:)
    mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dd8B (B:)
    mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dd8C (C:)
    mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dd8D (D:)
    mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd